SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017837 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017837
Domain Number 1 Region: 173-250
Classification Level Classification E-value
Superfamily HMG-box 1.14e-16
Family HMG-box 0.002
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000017837
Domain Number - Region: 778-799
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0294
Family Rubredoxin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017837   Gene: ENSPPYG00000015941   Transcript: ENSPPYT00000018552
Sequence length 1442
Comment pep:known_by_projection chromosome:PPYG2:5:151946304:151998398:1 gene:ENSPPYG00000015941 transcript:ENSPPYT00000018552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRSVVCRCCLCSRQTGASVTTVSLLSSSSSPGLDPRGPRQASLRSLRSEPVLLLYLPFTT
PYRDSEEGKREGLSRLRAVCRRAGPRGRGSSSPRDARASPRLHFLVAAVATGAASRRQRG
ARVRQPSPSSSCRAKRLRECERRGLHAPPAMDTSYDGTEVTVVMEEIEEAYCYTSPGPPK
KKKKYKIHGEKAKKPRSAYLLYYYDIYLKVQQELPHLPQSEINKKISESWRLLSVAERSY
YLEKAKLEKEGLDPNSKLSALTAVVPDIPGFRKILPRSDYIIIPKSSLQEDRSCPQLELC
VAQNQMSPKGPPLVSNTAPETVPSHAGMAEQCLAVEALAEEVGALTQSGAVQEIATSEIL
SQDVLLEDASLEVGESHQPYQTSLVIEETLVNGSPDLPTGSLAVPHPQVGESVSVVTVMR
DSSESSSSAPATQFIMLPLPAYSVVENPTSIKLTTTYTRRGHGTCTSPGCSFTYVTRHKP
PKCPTCGNFLGGKWIPKEKPAKVKVELASGVSSKGSVVKRNQQPVTTEQNSSKENASKLT
LENSEAVSQLLNVAPPREVGEESEWEEVIISDAHVLVKEAPGNCGTAVTKTPVVKSGVQP
EVTLGTTDNDSPGSDVPTPSEGTSTSSPLPAPKKPTGVDLLTPGSRAPELKGRARGKPSL
LAAARPMRAILPAPVNVGRGSSMGLPRARQAFSLSDKTPSVRTCGLKPSTLKQLGQPIQQ
PSGPGEVKLPSGPSNRTSQVKVVEVKPDMFPPYKYSCTVTLDLGLATSRGRGKCKNPSCS
YVYTNRHKPRICPSCGVNLAKDRTEKTTKAIEVSSPLPDVLNATEPLSTAQREIQRQSTL
QLLRKVLQIPENESELAEVFALIHELNSSRLILSNVSEETVTIEQTSWSNYYESPSTQCL
LCSSPLFKGGQNSLAGPQECWLLTASRLQTVTAQVKMCLNPHCLALHSFIDIYTGLFNVG
NKLLVSLDLLFAIRNQIKLGEDPRVSVNVVLKSVQEQTEKTLTSEELSQLQELLCNGYWA
FECLTVRDYNDMICGICGVAPKVEMAQRSEENVLALKSVEFTWPEFLGSNEVNVEDFWAT
METEVIEQVAFPASIPITKFDASVIAPFFPPLMRGAVVVNTEKDKNLDVQPVPGSGSALV
RLLQEGSCKLDEIGSYSEEKLQHLLRQCGIPFGAEDSKDQLCFSLLALYESVQNGARAIR
PPHHFTGGKIYKVCPHQVVCGSKYLVRGESARDHVDLLASSRHWPPVYVVDMATSVALCA
DLCYPELTNQMWGRNQGCFSSPTEPPVSVSCPELLDQHYTVDMTETEHSIQHPVTKTATR
RIVHAGIQPNPGDPSAGHHSLALCPELAPYATILASIVDSKPNSVRQRPIAFDNATHYYL
YNRLMDFLTSREIVNRQIHDIVQSCQPGEVVIRDTLYRLGVAQIKTETEEGGEEEEVATV
AE
Download sequence
Identical sequences H2PH23
ENSPPYP00000017837 ENSPPYP00000017837 9600.ENSPPYP00000017837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]