SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017857 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017857
Domain Number 1 Region: 22-85
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-28
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-27
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.54e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 522-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.48e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.66e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 568-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 264-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000108
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017857   Gene: ENSPPYG00000015957   Transcript: ENSPPYT00000018573
Sequence length 625
Comment pep:known_by_projection chromosome:PPYG2:5:152906000:152925302:-1 gene:ENSPPYG00000015957 transcript:ENSPPYT00000018573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCPGTEESLPVIWPFGRQQKMMKSQGLVSFKDVAVDFTQEEWQQLDPSQRTLYRDVMLE
NYSHLVSMGYPVSKPDVISRLEQGEEPWIIKGDISTWIYPDDYQADGRQDRKSNLHNSQS
CILGTVSFHHKILKGVTRDGSLCSILKVCQGDGQLQRFLENQDKLFRQVTFVNSKTVTEA
SGHKYNPLGKIFQECIETDTSIQRFHKYDAFKKNLKPNIDLPSCYKSNSRKKPDQSFGGG
KSSSQSEPNSNFEKIHNGVIPFDDNQCGNVFRNTQSLIQYQNVETKEKSCVCVTCGKAFA
KKSQLIVHQRIHTGKKPYDCGACGKAFSEKFHLVVHQRTHTGEKPYDCSECGKAFSQKSS
LIIHQRVHTGEKPYECNECGKAFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIH
HRAHTGEKPYECTECGKAFCEKSHLIIHKRIHTGEKPYKCAQCEEAFSRKTELITHQLVH
TGEKPYECTECGKTFSRKSQLIIHQRTHTGEKPYKCSECGKAFCQKSHLIGHQRIHTGEK
PYICTECGKAFSQKSHLPGHQRIHTGEKPYICADCGKAFSQKSDLVLHQRIHTGERPYQC
AICGKAFIQKSQLTVHQRIHTVVKS
Download sequence
Identical sequences H2PH41
ENSPPYP00000017857 ENSPPYP00000017857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]