SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017877 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017877
Domain Number 1 Region: 95-154
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017877   Gene: ENSPPYG00000015975   Transcript: ENSPPYT00000018593
Sequence length 215
Comment pep:known_by_projection chromosome:PPYG2:5:156632233:156635552:-1 gene:ENSPPYG00000015975 transcript:ENSPPYT00000018593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGG
PPPAAAAAAAAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELREC
IPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRE
LQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ
Download sequence
Identical sequences H2PH58
XP_002816159.1.23681 ENSPPYP00000017877 9600.ENSPPYP00000017877 ENSPPYP00000017877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]