SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017879 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017879
Domain Number 1 Region: 12-247
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.42e-90
Family CAF1-like ribonuclease 0.00000000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017879   Gene: ENSPPYG00000015977   Transcript: ENSPPYT00000018595
Sequence length 290
Comment pep:known_by_projection chromosome:PPYG2:5:156997710:157012340:1 gene:ENSPPYG00000015977 transcript:ENSPPYT00000018595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDY
QYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSG
LQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHE
FFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFR
MKEVSFLECDHRPLDSNLLKAKEVVDGLLCGLRFVERLFFIYLLCIVYFF
Download sequence
Identical sequences H2PH60
ENSPPYP00000017879 ENSPPYP00000017879 XP_009239500.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]