SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017931 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017931
Domain Number 1 Region: 1040-1377
Classification Level Classification E-value
Superfamily NHL repeat 4.18e-25
Family NHL repeat 0.001
Further Details:      
 
Domain Number 2 Region: 735-810
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000902
Family Pre-dockerin domain 0.057
Further Details:      
 
Domain Number 3 Region: 1273-1320,1348-1366,1393-1506
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000494
Family YVTN repeat 0.048
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000017931
Domain Number - Region: 479-504
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000437
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 576-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00093
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 546-570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.096
Further Details:      
 
Domain Number - Region: 412-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00261
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 611-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00304
Family EGF-type module 0.084
Further Details:      
 
Domain Number - Region: 447-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 382-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 1721-1794,2007-2074,2131-2165
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0777
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017931   Gene: ENSPPYG00000016021   Transcript: ENSPPYT00000018649
Sequence length 2577
Comment pep:known_by_projection chromosome:PPYG2:5:170503052:170899201:1 gene:ENSPPYG00000016021 transcript:ENSPPYT00000018649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLDSNTSHQIMDTNPDEEFSPNSYLLRACSGPQQASSGGPPNHHSQSTLRPPLPPPHN
HTLSHHHSSANSLNRNSLTNRRSQIHAPAPAPNDLATTPESVQLQDSWVLNSNVPLETRH
FLFKTSSGSTPLFSSSSPGYPLTSGTVYTPPPRLLPRNTFSRKAFKLKKPSKYCSWKCAA
LSAIAAALLLAILLAYFIAMHLLGLNWQLQPADGHTFNNGIRTGLPGNDDVATMPSGGKV
PWSLKNSSIDSGEAEVGRRVTQEVPPGVFWRSQIHISQPQFLKFNISLGKDALFGVYIRR
GLPPSHAQYDFMERLDGKEKWSVVESPRERRSIQTLVQNEAVFVQYLDVGLWHLAFYNDG
KDKEMVSFNTVVLDSVQDCPRNCHGNGECVSGVCHCFPGFLGADCAKAACPVLCSGNGQY
SKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCIDGNCVCSAGYKGEHCEEVDCLDPTC
SSHGVCVNGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDTGLCSCDPNWMGPDCSVE
VCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCT
IGRQTAGTETDGCPDLCNGNGRCTLGQNSWQCVCQTGWRGPGCNVAMETSCADNKDNEGD
GLVDCLDPDCCLQSACQNSLLCRGSRDPLDIIQQGQTDWPTVKSFYDRIKLLAGKDSTHI
IPGENPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGAS
LTLHFERAPFMSQERTVWLPWNSFYAMDTLVMKTEENSIPSCDLSGFVRPDPIIISSPLS
TFFSAAPGQNPIVPETQVLHEEIELPGSNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLI
RVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLI
LWEKRTALLQGFELEPSNLGGWSLDKHHILNVKSGILHKGTGENQFLTQQPAIITSIMGN
GRRRSISCPSCNGLAEGNKLLAPVALAVGIDGSLYVGDFNYIRRIFPSRNVTSILELRNK
EFKHSNNPAHKYYLAVDPVSGSLYVSDTNSRRIYRVKSLSGAKDLAGNSEVVAGTGEQCL
PFDEARCGDGGKAIDATLMSPRGIAVDKNGLMYFVDATMIRKVDQNGIISTLLGSNDLTA
VRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLENNVILRITENHQVSIIAGRPMHCQ
VPGIDYSLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAA
SDCDCKNDVNCNCYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVL
NAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTYSTDNDVTELIDNNGNSLK
IRRDSSGMPRHLLMPDNQIITLTVGTNGGLKVVSTQNLELGLMTYDGNTGLLATKSDETG
WTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSITIDIENSNRDDDVTVITNLSSVEASY
TVVQDQVRNSYQLCNNGTLRVMYANGMGVSFHSEPHVLAGTITPTIGRCNISLPMENGLN
SIEWRLRKEQIKGKVTIFGRKLRVHGRNLLSIDYDRNIRTEKIYDDHRKFTLRIIYDQVG
RPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFADGKVWSYSYL
DKSMVLLLQSQRQYIFEYDSSDRLLAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVI
FDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGVLKMVNLQSG
GFSCTIRYRKIGPLVDKQIYRFSEEGMVNARFDYTYHDNSFRIASIKPVISETPLPVDLY
RYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEMFRSLMYWMTV
QYDSMGRVIKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNP
GNSVRLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGSDIFEYNSKGLLTRAYNKASGWS
VQYRYDGVGRRASYKTNLGHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYDLQGHLFAM
ESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYD
PLTKLVHFTQRDYDVLAGRWTSPDYTMWKNVGKEPAPFNLYMFKSNNPLSSELDLKNYVT
DVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQASENGQLITGVQQTTERHNQAF
MALEGQVITKKLHASIREKAGHWFATTTPIIGKGIMFAIKEGRVTTGVSSIASEDSRKVA
SVLNNAYYLDKMHYSIEGKDTHYFVKIGSADGDLVTLGTTIGRKVLESGVNVTVSQPTLL
VNGRTRRFTNIEFQYSTLLLSIRYGLTPDTLDEEKARVLDQARQRALGTAWAKEQQKARD
GREGSRLWTEGEKQQLLSTGRVQGYEGYYVLPVEQYPELADSSSNIQFLRQNEMGKR
Download sequence
Identical sequences H2PHA8
ENSPPYP00000017931 ENSPPYP00000017931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]