SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018034 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018034
Domain Number 1 Region: 223-425
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.12e-48
Family Reprolysin-like 0.0022
Further Details:      
 
Domain Number 2 Region: 517-572
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000119
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 3 Region: 865-932
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000106
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 927-985
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 809-870
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018034   Gene: ENSPPYG00000016118   Transcript: ENSPPYT00000018754
Sequence length 1168
Comment pep:known_by_projection chromosome:PPYG2:5:181712065:181951330:-1 gene:ENSPPYG00000016118 transcript:ENSPPYT00000018754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPPGGPLGHGAERILAVPVRTDAQGRLVSHVVSAATARAGVRARRAAPVRTPSFPGGNEE
DPGSHLFYNVTVFGRDLHLRLRPNARLVAPGATMEWQGETGTTRVEPLLGSCVYVGDVAG
LAEASSVALSNCDGLAGLIRMEEEEFFIEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGG
PQALDTGASPGSLDSLSHALGVLEERINSSRRRARRHAADDDYNIEVLLGVDDSVVQFHG
KEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVC
RWAYLQQKPDTGHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSA
FVVAHETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSY
DCLRDDPFAHDWPALPQLPGLHYSMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNP
YFCKTKKGPPLDGTMCAPGKHCFKGHCIWLTPDILKRDGNWGAWSPFGSCSRTCGTGVKF
RTRQCDNPHPANGGRTCSGLAYDFQLCSRQDCPDSLADFREEQCRQWDLYFEHGDAQHHW
LPHEHRDAKERCHLYCESRETGEVVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCDGVI
GSSKQEDKCGVCGGDNSHCKVVKGTFTRSPKKHGYIKMFEIPAGARHLLIQEVDATSHHL
AVKNLETGKFILNEENDVGASSKTFIAMGVEWEYRDEDGRETLQTMGPLHGTITVLVIPV
GDTRVSLTYKYMIHEDSLNVDDNNVLEEDSVIYEWALKKWSPCSKPCGGGSQFTKYGCRR
RLDHKMVHRGFCAALSKPKAIRRACNPQECSQPVWVIGEWEPCSQSCGRTGMQVRSVRCI
QPLHNNTTRSVHTKHCNDARPESRRACNRELCPGRWRAGPWSQCSVTCGDGTQERPVLCR
TADDSFGICQEERPETARTCRLGPCPRNISDPSKKSYIVQWLSRPDPDSPIQKISSKGHC
QGDKSIFCRMEVLSRYCSIPGYNKLCCKSCNLHNNLTNVEGRIEPPPGKHNDIDVFMPTL
PVPTLAMEVQPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRR
PSPYEKTRNQRIQELIDEMRKKEMLGKF
Download sequence
Identical sequences H2PHK9
9600.ENSPPYP00000018034 ENSPPYP00000018034 ENSPPYP00000018034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]