SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018120 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018120
Domain Number 1 Region: 146-452
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.22e-116
Family Transglutaminase core 0.0000000000157
Further Details:      
 
Domain Number 2 Region: 2-145
Classification Level Classification E-value
Superfamily E set domains 9.45e-47
Family Transglutaminase N-terminal domain 0.0000000932
Further Details:      
 
Domain Number 3 Region: 500-598
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.45e-29
Family Transglutaminase, two C-terminal domains 0.00000128
Further Details:      
 
Domain Number 4 Region: 452-498
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000523
Family Transglutaminase, two C-terminal domains 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018120   Gene: ENSPPYG00000016200   Transcript: ENSPPYT00000018842
Sequence length 602
Comment pep:known_by_projection chromosome:PPYG2:6:6324257:6474072:-1 gene:ENSPPYG00000016200 transcript:ENSPPYT00000018842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFNRPYDPRRDLFRVEY
VIGRYPQENKTYIPVIVSELQSGKWGAKIVMREDRSVRLSVQSSPKCIVGKFRMYVAVWT
PYGVLRTSRNPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSW
SYGQFEDGILDTCLYVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAY
GVPPSAWTGSVDILLEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDND
ANLQMDIFLEEDGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDG
MYRCGPASVQAIKHGHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIV
TKQIGGDGMMDITDTYKFQEGQEEERALETALMKKEAVLIQAGEYMGQLLEQASLHFFVT
ARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGSDMTVTVEFTNPLKETLRNVWIHLDG
PGITRPMRKMFREIRPNSTVQWEEVCRPWVSGHRKLIASMSSDSLRHVYGELDVQIQRRP
SM
Download sequence
Identical sequences H2PHU5
ENSPPYP00000018120 ENSPPYP00000018120 9600.ENSPPYP00000018120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]