SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018158 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018158
Domain Number 1 Region: 406-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000324
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 2075-2123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000228
Family Classic zinc finger, C2H2 0.0014
Further Details:      
 
Domain Number 3 Region: 943-971
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000366
Family C2HC finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018158   Gene: ENSPPYG00000016236   Transcript: ENSPPYT00000018882
Sequence length 2705
Comment pep:known_by_projection chromosome:PPYG2:6:12424953:12577205:1 gene:ENSPPYG00000016236 transcript:ENSPPYT00000018882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRTKQIHPRNLRDKIEEAQKELNGAEVSKKEILQAGVKGTSESLKGVKRKKIVAENHLK
KIPKSPLRNPLQAKHKQNTEESSFALLHSALESHKKQNYIPVKNGKQFTKQNGETPGIIA
EATKSDESVSPKKPLFLQHPSELRRWRSEGADPAKFSDLDEQCDSSSLSSKTRTDNSECI
SSHCGTTSPSYTNTAFDVLLKAMEPELSTLSQKGSSCAIKTEKLRPNKAARSPSKLKNSS
MDTPNQTSQELVAESQSSCTSYTVHVSAAQKNEQGAVQSASHLYHQHEHFVPKSNQHNQQ
LPRCSGFTGSLTNLQNQENAKLEQVYNIAVTSSVGLTSPSSRSQVTPQNQQMDSASPLSI
SPANSTQSPPMPIYNSTHVASVVNQSVEQMCNLLLKDQKPKKQGKYICEYCNRACAKPSV
LLKHIRSHTGERPYPCVTCGFSFKTKSNLYKHKKSHAHTIKLGLVLQPDAGGLFLSHESP
KALSIHSDVEDGESEEECTEERQHDLGGMELQPVIIKKMSIAETLLNVVGDVLLQDKSAE
SQGVTELPKVVVHHVTVSPLRTDSPKAVDPKPELSSAQKQKDLQVTNVQPLSANMSQGGI
SRLETNEKSHQKGDMNPLEGKQDSHIGTVHAQLQRQQATDYSQEQQGKLLSPRSLGSTDS
GYFSRSESADQTVSPPTPFTRRLPSTEQDSGRSNGPSAALVTTSTPSALPTGEKALLLPG
QMRPPLATKTLEERISKLISDNEALVDDKQLDSVKPRRTSLSRRGSIDSPKSYIFKDSFQ
FDLKPVGRRTSSSSDIPKSPFTPTEKSKQVFLLSVPSLDCLPITRSNSMPTTGYSAVPAN
IIPPPHPLRGSQSFDDKIGAFYDDVFVPGPNTPVPQSGHPRTLVRQAAIEDSSANESHVL
GTGQSLDESHQGCHAAGEATSARSKALAQGPHIEKKKSHQGRGTMFECETCRNRYRKLEN
FENHKKFYCSELHGPKTKVAMREPEHSPVPGGPQPQILHYRVAGSSGIWEQTPQIRKRRK
MKSVGDDDELQQNESGTSPKSSEGLQFQNALGCNPSLPKHNVTIRSDQQHKNIQLQNSQI
HLVARGPEQTMDPKLSTIMEQQISSAAQDKIELQRHGTGISVIQHTNSLSRPNSFDKPEP
FERASPVSFQELNRTGKSGSLKVIGISQEESHPSRDGSHPHQLALSDALRGELQESSRKS
PSERHVLGQPSRLVRQHNIQVPEILVTEEPDRDLEAQCHDQEKSEKFSWPQRSETLSKLP
TEKLPPKKKRLRLAEIEHSSTESSFDSTLSRSLSRESSLSHTSSFSASLDIEDVSKTEAS
PKIDFLNKAEFLMIPAGLNTLNVPGSHREMRRTASEQINCTQTSMEVSDLRSKSFDCGSI
TPPQTTPLTELQPPSSPSRVGVTGHVPLLERRRGPLVRQISLNIAPDSHLSPVHPTSFQN
IALPSVNAVPYQGPPLTSTYLAEFSANTLHSQTQVKDLQAETSNSSSTNIFPVQQLCDIN
LLNQIHAPPSHQSTQLSLQVSTQGSKPDKNSVLSGSSKSENCFAPKYQLHCQVFTSGPSC
SSNLVHSLPNQVISDPVGTDHCVTSAALPTKLIDSLSNSHPLLPPELRPLGSQVQKVPSS
FMLPVCLQSNVPAYCFATLTSLPQILVTQDLPNQPVCQTNHSVVPISEEQNSVPTLQKGH
QNALPNPEKEFLYENVFLKMGQNSSLSESLPITQKISVGRLSPQQESSASSKRMLSPANS
LDIAMEKHQKRAKDENGAVCATDVRPLEPLSSRVNEASKQKKPILVRQVCTTEPLDGVML
EKDVFSQPEISSEAVNLTNVLPADNSSTGCSKFVVIEPISELQEFENIKSSTSLTLTVRS
SPVPSENTHISPLKCTDNNQERKSPGVKNQGDKVNIQEQSQRPVTSLSLFNIKDTQQLAF
PSLKTTTNFTWCYLLRQKSLHLPQKDQKTSAYTDWTVSSSNPNPLGLPTKVALSLLNSKQ
NTGKSLYCQAITTHSKSDLLVYSSKWKSNLSKRALGNQKSTVVEFSNKDASEINSEQDKE
NSLIKSEPRRIKIFDGGYKSNEEYVYVRGRGRGKYICEECGIRCKKPSMLKKHIRTHTDV
RPYHCTYCNFSFKTKGNLTKHMKSKAHSKKCVDLGVSVGLIDEQDTEESDEKQRFSYERS
GYDLEESDGPDEDDNENEDDDEDSQAESVLSATPSVTASPQHLPSRSSLQDPVSADEDVR
ITDCFSGVHTDPMDVLPRALLTKMTVLSTAQSDYNRKTLSPGKARQRAARDENDTIPSVD
TSRSPCHQMSVDYPESEEILRSSVAGKAIAITQSPSSVRLPPAAAEHSPQTAAGVPSVAS
PHPDPQEQKQQITLQPTPGLPSPHTHLFSHLPLHSQQQSRTPYNMVPVGGIHVVPAGLTY
STFVPLQAGPVQLTIPAVSVVHRTLGTPGNTVTEVSGTTNPAGVAELSSVVPCIPIGQIR
VPGLQNLSTPGLQSLPSLSMETVNIVGLANTNMAPQVHPPGLALNAVGLQVLTANPSSQS
SPAPQAHIPGLQILNIALPTLIPSVSQVTVDAQGAPEMPASQSKACETQPKQTSVASANQ
VSRTESPQGSPKVQGENAKKVLNPPAPAGDHARLDGLSKMDTEKAASANHVKPKPELTSV
QGQPASTSQPLLKAHSEVFTKPSGQQTLSPDRQVPRPTALPRRQPTVQFSDVSSDDDEDR
LVIAT
Download sequence
Identical sequences H2PHY2
9600.ENSPPYP00000018158 ENSPPYP00000018158 ENSPPYP00000018158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]