SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018223 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018223
Domain Number 1 Region: 102-399
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.01e-46
Family LacY-like proton/sugar symporter 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018223   Gene: ENSPPYG00000016295   Transcript: ENSPPYT00000018948
Sequence length 415
Comment pep:known_by_projection chromosome:PPYG2:6:26935664:26964974:-1 gene:ENSPPYG00000016295 transcript:ENSPPYT00000018948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKTELSPTARESKNAQDMQVDEALIPRKVPSLCSARYGIALVLHFCNFTTIAQNVIMN
ITMVAMVNSTSLQSQLNDSSEGLPVDSFGGLSKAPKCSILGGQFAIWEKWGPPHERSRLC
SIALSGMLLGCFTAILIGGFISETLGWPFVFYIFGGVGCVCCLLWFVVIYDDPVSYPWIS
TSEKEYIISSLKQQVRSSKQPLPIKAMLRSLPIWSICLGCFSHQWLVSTMVVYIPTYISS
VYHVNIRDNGLLSALPFIVAWVIGMVGGYLADFLLTKKFRLITVRKIATILGSLPSSALI
VSLPYLNSSYITATALLTLSCGLSTLCQSGIYINVLEIAPRYSSFLMGASRGFSSIAPVI
VPTVSGFLLSQDPEFGWRNVFFLLFAVNLLGLIFYLIFGEADVQDWAKERKLTRL
Download sequence
Identical sequences H2PI45
ENSPPYP00000018223 9600.ENSPPYP00000018223 ENSPPYP00000018223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]