SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018266 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018266
Domain Number 1 Region: 136-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 191-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.11e-22
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 233-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 79-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.88e-19
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 42-93
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000176
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 339-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000478
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 7 Region: 275-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000792
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018266   Gene: ENSPPYG00000016336   Transcript: ENSPPYT00000018993
Sequence length 402
Comment pep:known_by_projection chromosome:PPYG2:6:27768004:27769212:-1 gene:ENSPPYG00000016336 transcript:ENSPPYT00000018993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTSEERCNQRTQKRKIYNVCPQKGKKIFIHVHEITQIDGHIYQCLECKQNFCENLALIM
CERTHTGEKPYKCDMCEKTFVQSSDLISHQRIHNYEKPYKCSKCEKSFWHHLALSGHQRT
HAGKKFYTCDICGKNFGQSSDLLVHQRSHTGEKPYLCSECDKCFSRSTNLIRHRRTHTGE
KPFKCLECEKAFSGKSDLISHQRTHTGERPYKCNKCEKSYRHRSAFIVHKRVHTGEKPYK
CGACEKCFGQKSDLIVHQRVHTGEKPYKCLECMRSFTRSANLIRHQATHTHTFKCLEYEK
SFNCSSDLIVHQRIHMEEKPHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCDKSF
HQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS
Download sequence
Identical sequences H2PI76
XP_002816589.1.23681 XP_003776819.1.23681 XP_009239796.1.23681 XP_009239797.1.23681 XP_009239798.1.23681 ENSPPYP00000018266 ENSPPYP00000018266 9600.ENSPPYP00000018266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]