SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018293 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018293
Domain Number 1 Region: 36-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.33e-38
Family SCAN domain 0.0000606
Further Details:      
 
Domain Number 2 Region: 244-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-24
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 
Domain Number 3 Region: 290-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.09e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018293   Gene: ENSPPYG00000016364   Transcript: ENSPPYT00000019021
Sequence length 348
Comment pep:known_by_projection chromosome:PPYG2:6:28998545:29004271:1 gene:ENSPPYG00000016364 transcript:ENSPPYT00000019021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTALEPEDQKGLLVIKAEDHYWGQDSSSQKCSPHRRELYRQHFRKLCYQDAPGPREALT
QLWELCRQWLRPECHTKEQILDLLVLEQFLSILPKDLQAWVHAHHPETGEEAVTVLEDLE
RELDEPGKQVSGNSEREDILMDKLAPLGRPYESLTVQFHPKKTQLEQEAGIPLRNGDKTR
TKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQRERRRYKCDE
CGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGVKPYKCKECGKD
FSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHATNKLY
Download sequence
Identical sequences H2PI99
ENSPPYP00000018293 9600.ENSPPYP00000018293 XP_002816626.2.23681 ENSPPYP00000018293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]