SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018306 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018306
Domain Number 1 Region: 45-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.03e-40
Family SCAN domain 0.0000256
Further Details:      
 
Domain Number 2 Region: 376-527
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.34e-17
Family Retroviral integrase, catalytic domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018306   Gene: ENSPPYG00000016376   Transcript: ENSPPYT00000019034
Sequence length 688
Comment pep:known_by_projection chromosome:PPYG2:6:29500609:29512751:-1 gene:ENSPPYG00000016376 transcript:ENSPPYT00000019034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVSRVFPALAGQAPEEQGEIIKVKVKEEDHTWDQESALPRNLSYTRELSRQHFRQFCY
QETPGPREALSQLRELCRQWLNPEIHTKEQILELLVLEQFLTILPEELQSWVREHNPESG
EEVVTLLEDLERELDEPRQQASQGTYGQEVSMEERTPLDSTKESLGTQLQSMEDRMECES
PEPHPLQDNGSFLWFSMMSQSMGDDNLSSLDTNEAEIEPENMREKFFRSLAMLLENKSNN
TKIFSKAKYCQLIKEVKEAKAKAKKESVDYRRLARFDVILVQGNEKLIEAVNGETDKIRY
YLHSEDLFDILHNTHLSIGHGGRTRMEKELQAKYKNITKEVIMLYLTLCKPCQQKNSKLK
KVLTSKPIKEVSSRCQVDLIDMQLNPDGEYKFILHYQDLRTKLSFLRSLKSKRPTEVAHA
LLDIFTVIGAPSVLQSDNGREFSSQVVSELSNIWPELKIVHGKSQTCQSQSSAEQTEDIR
KRIFSWMQTNNSSHWAEFLWFIQMSQNQPYHRSMQQTPCESAFSSEAKLGLSHSQLTEEL
VASLHTENELDQADKELENTLRAQYEENIETGTDSSDIEENLSVTPKVAEKSPPESRLRF
LSCVVCEKECTGVNSCISCDGNIHAICGVPSQHGTEGCGRQITCSLCYETSTKKRKHDEI
QRSLPVKPSKMLKPSGTPFSPDKVGDWV
Download sequence
Identical sequences H2PIB2
ENSPPYP00000018306 ENSPPYP00000018306 9600.ENSPPYP00000018306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]