SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018329 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018329
Domain Number 1 Region: 20-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-21
Family KRAB domain (Kruppel-associated box) 0.00069
Further Details:      
 
Domain Number 2 Region: 192-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.39e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 154-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000144
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 4 Region: 363-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000563
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 400-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000148
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018329   Gene: ENSPPYG00000016397   Transcript: ENSPPYT00000019060
Sequence length 516
Comment pep:known_by_projection chromosome:PPYG2:6:30635140:30639850:-1 gene:ENSPPYG00000016397 transcript:ENSPPYT00000019060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEQLKPIEPRDCWREAWVKKKPVTFEDVAVNFTQEEWDCLDASQRVLYQDVMSETFKNL
TSVARIFLHKPELITKLEQEEEQWREFVHLPNTEGLSEGKKKELREQHASLRDEGTSDDK
VFLACRGAGQCPLSASAGSMDRTRVLQASQAGPPFFCHTCGKCFSRRSYLYSHQFVHNPK
LTNSCSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTYCDASGLSRHRRVHLGYRPHS
CSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGTPAEFQTPIARSQRSIQGLLD
VNHAPVARSQEPIFRTEGPMAQNQPSVLKNQAPVTRTQAPITGTPCQDARSNSHPVKPSR
LNVFCCPHCPVTFSKKSYLSRHQKAHLTEPPNYCFHCSKSFSSFSRLVRHQQTHWKQKSY
RCPICDLSFGEKEHFMDHWRGYKGKELCQSSHHKCRVILGQWLGFSHDAPTMAGEEWKHG
GDQSPPRVHTPRRRGLREKACKEDKTKEAVSILKHK
Download sequence
Identical sequences H2PID5
ENSPPYP00000018329 9600.ENSPPYP00000018329 ENSPPYP00000018329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]