SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018413 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018413
Domain Number 1 Region: 192-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000648
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 229-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000622
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000018413
Domain Number - Region: 164-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000262
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018413   Gene: ENSPPYG00000016468   Transcript: ENSPPYT00000019148
Sequence length 292
Comment pep:novel chromosome:PPYG2:6:32399591:32400466:-1 gene:ENSPPYG00000016468 transcript:ENSPPYT00000019148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPPLPPPLLRPVKLEFPLDEDLELKAEDEDEDEDEDVSDICIVKVESALEVAHRLKPPG
GLGGGLGIGGSVGGHLGELAQSSVPPSTVAPPQGVVKACYSLSEDAEGEGLLLIPGGRAS
VGATSGLVEAAAVAMAARGAGGSLGAGGSRGPLPGGFSGGNPLKNIKCTKCPEVFQGVEK
LVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLN
LHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGKTTAENVLEASVAEINVLIR
Download sequence
Identical sequences H2PIL2
9600.ENSPPYP00000018413 ENSPPYP00000018413 ENSPPYP00000018413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]