SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018417 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018417
Domain Number 1 Region: 474-758
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.61e-62
Family Eukaryotic proteases 0.000000000103
Further Details:      
 
Domain Number 2 Region: 203-472
Classification Level Classification E-value
Superfamily vWA-like 4.01e-59
Family Integrin A (or I) domain 0.00000000151
Further Details:      
 
Domain Number 3 Region: 97-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000306
Family Complement control module/SCR domain 0.0000194
Further Details:      
 
Domain Number 4 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000639
Family Complement control module/SCR domain 0.0000237
Further Details:      
 
Domain Number 5 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000542
Family Complement control module/SCR domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018417   Gene: ENSPPYG00000016470   Transcript: ENSPPYT00000019152
Sequence length 764
Comment pep:known chromosome:PPYG2:6:32446215:32455767:1 gene:ENSPPYG00000016470 transcript:ENSPPYT00000019152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNLSPQLCLMPFILGLLSGGVTTTPLSLARSQGSCSLEGIEIKGGSFRLLQDGQALEY
VCPSGFYPYPVQTRTCRSTGSWSTLQTQDQKTVKKAECRAIRCPRPHDFENGEYWPRSPY
YNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQ
YRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTE
TIEGVDAEDGHSPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGAGNFTGAKKCLVNLIEKV
ASYGVKPRYGLVTYATYPKIWVKVSEPDSSNADWVTKQLNEINYEDHKLKSGTNTKKALQ
AVYSMMSWPDDIPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE
DYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFFQMIDESQSLSLCGM
VWEHRKGTDYHKQPWQAKISVTRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVS
VGGKKQDLEIEEVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLNYHQTIRPICLPCT
EGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDA
QYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWG
VVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKQKLQDEDLGFL
Download sequence
Identical sequences H2PIL6
9600.ENSPPYP00000018417 XP_009239977.1.23681 ENSPPYP00000018417 ENSPPYP00000018417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]