SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018437 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018437
Domain Number 1 Region: 1577-1819
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.4e-54
Family Ankyrin repeat 0.000000953
Further Details:      
 
Domain Number 2 Region: 477-592
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 357-478
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000487
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 587-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000925
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 275-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 157-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000145
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 895-1008
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000251
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 766-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000553
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1045-1089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000566
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 676-801
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000596
Family Growth factor receptor domain 0.0036
Further Details:      
 
Domain Number 11 Region: 234-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.025
Further Details:      
 
Domain Number 12 Region: 1251-1282
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0025
Further Details:      
 
Domain Number 13 Region: 1004-1046
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000328
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 14 Region: 312-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000858
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 807-932
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000104
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 16 Region: 193-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000328
Family EGF-type module 0.012
Further Details:      
 
Domain Number 17 Region: 65-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000503
Family EGF-type module 0.013
Further Details:      
 
Domain Number 18 Region: 31-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.019
Further Details:      
 
Domain Number 19 Region: 1214-1244
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 20 Region: 119-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000224
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000018437
Domain Number - Region: 1173-1202
Classification Level Classification E-value
Superfamily Notch domain 0.00183
Family Notch domain 0.0035
Further Details:      
 
Domain Number - Region: 1087-1124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00273
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1132-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00599
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 624-655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0131
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018437   Gene: ENSPPYG00000016488   Transcript: ENSPPYT00000019172
Sequence length 2000
Comment pep:known_by_projection chromosome:PPYG2:6:32687933:32717512:-1 gene:ENSPPYG00000016488 transcript:ENSPPYT00000019172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLLLLLLLLCVSVVITRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGET
CQFPDPCQNAQLCQNGGSCQALLPTPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLEDP
CPTSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQCH
CPPGFEGHACERDVNECFQDPGPCPKGTSCHNTGSFQCLCPVGREGPRCELRAGPCPPRG
CSNGGTCQLMPGKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTCLC
PETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAA
TCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQP
GYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQ
PCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICLPG
FAGTRCEEDIDECRNSPCANGGQCQDQPGAFHCECLPGFEGTRCQTEVDECLSDPCPVGA
SCIDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPE
DNCTCHHGHCQRSSCVCDVGWTGPECEAELGSCISAPCAHGGTCYPQPSGYNCTCPTGYT
GPTCSEETTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCGSAPCFNGGTC
VNRPGTFSCLCATGFQGPRCEGKIRPSCADSPCRNTATCQDSPQGPRCLCPTGYTGGSCQ
TLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCH
NGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGYDG
QNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAA
CHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFEGP
TCSHRAPSCGLHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLY
NGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPEGNWDGGD
CSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDH
FHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLRPPALDQQLFALARVLSLT
LRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAGFV
VVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAPPA
NQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRRRP
PLGEDSIGLKALKPEAEVDEDGVVMCSGPEEGEEVDQAEETGPPSKCQLWSLSGGCGALP
QAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVESRTFQEAWLGCPEPWEPLLDG
GACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAREV
CQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAA
AVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLVLGAARELRDQAGLA
PADVARQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTASVSVPPHGGGALPRCR
TLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPPPRGRRFSAGMRG
PRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPERGSPQ
LDCGPSAHQEMPINQGGEGK
Download sequence
Identical sequences H2PIN6
ENSPPYP00000018437 ENSPPYP00000018437 9600.ENSPPYP00000018437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]