SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018465 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018465
Domain Number 1 Region: 45-250
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.75e-55
Family L-arabinose binding protein-like 0.0000061
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000018465
Domain Number - Region: 259-447
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00262
Family LacY-like proton/sugar symporter 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018465   Gene: ENSPPYG00000016512   Transcript: ENSPPYT00000019202
Sequence length 461
Comment pep:novel chromosome:PPYG2:6:34038091:34126041:-1 gene:ENSPPYG00000016512 transcript:ENSPPYT00000019202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLGLGMSISYA
ALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVVDPSHSVVD
FQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPETFNEAKPIG
FTMYTTCIVWLAFIPIFFGTSQSADKLATKQTYVTYTNHAI
Download sequence
Identical sequences H2PIR4
ENSPPYP00000018465 ENSPPYP00000018465 9600.ENSPPYP00000018465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]