SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018498 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018498
Domain Number 1 Region: 545-577,716-790
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000769
Family Anti-sigma factor antagonist SpoIIaa 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018498   Gene: ENSPPYG00000016538   Transcript: ENSPPYT00000019235
Sequence length 969
Comment pep:known_by_projection chromosome:PPYG2:6:35954458:36032065:-1 gene:ENSPPYG00000016538 transcript:ENSPPYT00000019235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLERSAISGFSSKSRRNSFTYDVKREVYNEETFQQEHKRKASSSGNMNINITTFRHHV
QCRCSWHRFLRCMLTIFPFLEWMCMYRLKDWLLGDLLAGISVGLVQVPQVLTLSLLARQL
IPPLNIAYAAFCSSVIYVIFGSCHQMSIGSFFLVSALLINVLKVSPFNSGQLVMGSFVKN
EFSAPSYLMGYNKSLSVVATTTFLTGIQLIMGVLGLGFIATYLPESAMSAYLAAVALHIM
LSQLTCIFGITISFHAGPISFFYDIINYCITLPKANSTSILLFLTVVVVLRINKCIRISF
NQYPIEFPMELFLIIGFTVIANKISMATETSQTLIDMIPYSFLFPVTPDFSLLPKIILQA
FSLSLVSSFLLIFLGKKIASLHNYSVNSNQDLIAIGLCNVVSSFFRSCVFTGAVARTIIR
DKSGGRQQFASLVGAGVMLLLMGKMGHFFYALPNAVLAGIILSNVVPYLETISNLPSLWR
QDQYDCAPFMMTFSSSIFLGLDIRLIISVVSAFFITTVRSHRAKILLLGQIPNTNIYRSI
NDYREIITIPGVKIFQCCSSITFVNVYYLKHKLLKEVDMVRVPLKEEEIFSLFNSSDTNL
QGEKICRCFCNCDDLEPLPRILYTERFENKLDPDASSVNLIHCSHFESMNTSQTTSEDQV
PYTVSSVSQKNQGQQYEEVEKIWLPNNSSINSSPGLPDVAESQGRRSLIPYSDVSLLPSV
HTIILDFSMVHYVDSRGLVVLRQICNAFQNANILILIAGCHSSIVRAFERNDFFDAGITK
TQLFLSVHDAVLFALSRKFIGSSELSIDESETVIRETYSETEKNDNSTYKMSSSVLGSQK
NVSPGFTKIQQPVEEESELDLELESEQEAGLGLDLDLDRELEPEMEPKAETETETETEME
PQPETEPEMEPDPKSRPRAHTFPQQRYRPMYHPSMASTQSQTETRTWSVERRRHPMDSYS
PEGNSNEDV
Download sequence
Identical sequences H2PIU5
ENSPPYP00000018498 9600.ENSPPYP00000018498 ENSPPYP00000018498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]