SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018565 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018565
Domain Number 1 Region: 334-403
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000497
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000018565
Domain Number - Region: 394-482
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0523
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018565   Gene: ENSPPYG00000016599   Transcript: ENSPPYT00000019304
Sequence length 581
Comment pep:known_by_projection chromosome:PPYG2:6:41769520:41826763:-1 gene:ENSPPYG00000016599 transcript:ENSPPYT00000019304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCCPLPGAEGSVRGVTAGARAPGAGLGDSGGGGPGGTQGAAAAPTAAGRADGAGLPGGAG
PEQPGSRWRAQLAGQAPELGTSCRSRGARAADRLTFRAREPTPAATMASRIGLRMQLMRE
QAQQEEQRERMQQQAVMHYMQQQQQQQQQLGGPPTPAINTPVHFQSPPPVPGEVLKVQSY
LENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSA
GNSAPNSPMAMLHIGSNPEREFDDVIDNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYS
SDPQVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNHNLIERRRRFNINDRI
KELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLR
IQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEALMLGAEVPDPEPLPAL
PPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPEHGSPFPSLSKKDLDL
MLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL
Download sequence
Identical sequences H2PJ06
ENSPPYP00000018565 ENSPPYP00000018565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]