SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018636 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018636
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.77e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000139
Further Details:      
 
Domain Number 2 Region: 207-418
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 7.59e-45
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00012
Further Details:      
 
Domain Number 3 Region: 542-718
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.96e-32
Family AlaX-like 0.032
Further Details:      
 
Domain Number 4 Region: 467-542
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000424
Family AlaX-M N-terminal domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018636   Gene: ENSPPYG00000016659   Transcript: ENSPPYT00000019375
Sequence length 907
Comment pep:known_by_projection chromosome:PPYG2:6:44251168:44266172:-1 gene:ENSPPYG00000016659 transcript:ENSPPYT00000019375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGHHNDLEDVGQDLSHHTFFEMLGNWA
FGGEYFKEEACNMAWELLTQVYGIPEERLWVSYFDGDPKAGLDPDLETRDIWLSLGVPAS
RVLSFGPQENFWEMGDTGPCGPCTEIHYDLAGGVGAPQLVELWNLVFMQHNREADGSLQP
LPQRHVDTGMGLERLVAVLQGKHSTYDTDLFSPLLNAIQQGCRAPPYLGRVGVADEGRTD
TAYRVVADHIRTLSVCISDGVFPGMSGPPLVLRRILRRAVRFSVEILKAPPGFLGSLVPV
VVETLGDAYPELQRNSAQIANLVSEDEAAFLASLERGRRIIDRTLRTLGPSDMFPAEVAW
SLSLCGDLGLPLDMVELMLEEKGVQLDSAGLERLAQEEAQHRARQAEPVKKQGLWLDVHA
LGELQRQGVPPTDDSPKYNYSLQPSGSYEFGTCEAQVLQLYTEDGTAVASVGKGQRCGLL
LDRTNFYAEQGGQASDRGYLVRAGQEDVLFPVARAQVCGGFILHEAVAPECLQIGDQVQL
HVDKAWRLGCMAKHTATHLLNWALRQTLGPGTEQQGSHLSPEQLRLDVTTQTPLTPEQLR
AVENTVQEAVGQDEAVYMEEVPLALTAQVPGLRSLDEVYPDPVRVVSVGVPVAHALDPAS
QAALQTSVELCCGTHLLRTGAVGDLVIIGDRQLSKGTTRLLAITGEQAQQARELGQSLAQ
EVKAATERLSQGSRDVAEALRLSKDIGRLIEAVETAVMPQWQRRELLATVKMLQRRANTA
IRKLQMGQAAKKTQELLERHSKGPLIVDTVSAESLSVLVKVVRQLCEQAPSTSVLLLSPQ
PVGKVLCACQVAQGATPTFTAEAWALAVCSHIGGKAWGSRVVAQGTGSTTDLEAALSIAR
TYALSQL
Download sequence
Identical sequences H2PJ76
ENSPPYP00000018636 ENSPPYP00000018636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]