SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018898 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018898
Domain Number 1 Region: 612-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.88e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 575-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.74e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 653-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000016
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 100-204
Classification Level Classification E-value
Superfamily SET domain 0.00000000000523
Family Histone lysine methyltransferases 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018898   Gene: ENSPPYG00000016879   Transcript: ENSPPYT00000019644
Sequence length 825
Comment pep:known_by_projection chromosome:PPYG2:6:108021562:108042998:1 gene:ENSPPYG00000016879 transcript:ENSPPYT00000019644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDICLEKRVGTTLAAPKCNSSAVRFQGLAEGIKGTMKMDMEDADMTLWTEAEFEEKCTY
IVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEI
YTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGM
NIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQTQSNLKQPSTEKNELCP
KNVPKREYSVKEILKLDSNPSKGKDLCRSNISPLTSEKDLDDFRRHGSPEMPFYPRVVYP
IRAPLPEDFLKASLAYGMERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTV
SPVGPGSQEHRDSYSYLNAPYGTEGLGSYPGYAPLPHLPPAFIPSYNAHYPKFLLPPYGM
NCNGLSAVSSMNGINNFGLFPRLCPVYSNLLGGGSLSHPMLNPTSLPGSLPSDGARRLLQ
PEHPREVLVPAPHSAFSLTGAAASMKDKACSPTSGSPTAGTAATAEHVVQPKATSAAMAA
PSSDEAMNLIKNKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGE
RPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQ
CKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNCAAAPAPGLPS
EDLTRINEEIEKFDISDNADRLEDVEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNM
GNGLLSSGCSLYESSDLPLMKLPPSNPLPLVPVKVKQETVEPMDP
Download sequence
Identical sequences H2PJX9
ENSPPYP00000018898 ENSPPYP00000018898 XP_002817245.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]