SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018931 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018931
Domain Number 1 Region: 78-195
Classification Level Classification E-value
Superfamily POZ domain 5.89e-27
Family BTB/POZ domain 0.0018
Further Details:      
 
Domain Number 2 Region: 482-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 369-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 411-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 527-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-16
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018931   Gene: ENSPPYG00000016910   Transcript: ENSPPYT00000019678
Sequence length 764
Comment pep:known_by_projection chromosome:PPYG2:6:111542521:111563057:-1 gene:ENSPPYG00000016910 transcript:ENSPPYT00000019678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWLWLWLWRRRRGRNRCGAEAPEAGGAERRASGPRRGYPARPPGELAATRTPPGAPERFN
PSWLLKKMAETSPEPSGQLVVHSDAHSDTVLASFEDQRKKGFLCDITLIVENVHFRAHKA
LLAASSEYFSMMFAEEGDIGQSIYMLEGMVADTFGILLEFIYTGYLHASEKSTEQILATA
QFLKVYDLVKAYTDFQNNHSSPKPTTLNTAGAPVVVISNKKNDPPKRKRGRPKKVNTLQE
EKSELAAEEEIQLRVNNSVQNRQNFVVKGDSGVLHEQIAAKEKEESEPTCEPSREGEMPV
EKDENYDPKTADGQASQSRYSKRRIWRSIKLKDYKLVGDQEDHGSAKRICGRRKRPGGPE
ARCKDCGKVFKYNHFLAIHQRSHTGERPFKCNECGKGFAQKHSLQVHTRMHTGERPYTCT
VCSKALTTKHSLLEHMSLHSGQKSFTCDQCGKYFSQNRQLKSHYRVHTGHSLPECKDCHR
KFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCGICGKSFSD
SSAKRRHCILHTGKKPFSCPECNLQFARLDNLKAHLKIHSKEKHVSDASSISGSSNTEEV
RNILQLQPYQLSTSGEQEIQLLVTDSVHNINFMPGPSQGISIVTAESSQNMTADQAANLT
LLTQQPEQLQNLILSAQQEQTEHIQSLNMIESQMGPSQTEPVHVITLSKETLEHLHAHQE
QTEELHLATSTSNPAQHLQLTQEPDPPPPTHHVPQPAPLGQEQS
Download sequence
Identical sequences H2PK09
ENSPPYP00000018931 ENSPPYP00000018931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]