SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018949 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018949
Domain Number 1 Region: 2588-2998
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.45e-112
Family DNA polymerase I 0.0000323
Further Details:      
 
Domain Number 2 Region: 29-66,97-173,2286-2323,2364-2548
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.1e-70
Family DnaQ-like 3'-5' exonuclease 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018949   Gene: ENSPPYG00000016927   Transcript: ENSPPYT00000019698
Sequence length 3117
Comment pep:known_by_projection chromosome:PPYG2:6:113479025:113668465:-1 gene:ENSPPYG00000016927 transcript:ENSPPYT00000019698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSVRIVRAEYMASPLQEQNTCQSPLKQDPVKKVPVVRVFGATPAGQKTCLHLHGIFPYL
YVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERH
FMKIYLYNPAMVKRICELLQSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAVK
FRKARRKSNTLHATGSCKNHLSGNSLADTLFRWEQDEIPSSLILEGVEPQSTCELEVDAV
AADILNRLDIEAQIGGNPGLQAIWEDEKQRRRNRNETSQMSQPESQDHRFVPATESEKKF
QKRLQEILKQNDFSVTLSGSVDYSDGSQEFSAELTLHSEVLSPEMLQCTPANMVEVHKDE
ESSKGHTRHKVEEALINEEAILNLMENSQTFQPLTQRLSESPVFMDSSPDEALVHLLAGL
ESDGYRGERNRMPSPCRSFGNNKYPQNSDDEENEPQIEKEEMELSLVMSQRWDSNIEEHC
AKKRSLCRNTHRSSTEDDDSSSEEEMEWSDNSLLLANLSIPQLDGTADENSDNPLNNENS
RTHSSVIATSKLSVKPSIFHKDAATLEPSSSAKITFQCKHTSALSSHVLNKEDLIEDLSQ
TNKNIEKGLDNSVTSFTNESTYSVKYPGSLSSTVHSENSHKENSKKEILPVSSCESSIFD
YEEDIPSVTRQVPSRKYTNIRKIEKDSPFIHMHRHPNENTLGKNSFNFSDLNHSKNKVSS
EGNEKGNSTALSSLFPSSFTENCELLSCSGENRTMVHNSTADESGLNKLKRYEEFQERKT
EKPSSQQAAHYMFPSVLSNCLTRPQKLSPVTYKLQPGNKPSRLKLNKRKLAGHQETSTKS
SETGSTKDNFIQNNPCNSNPEKDNALASDLTKTTRGAFENKTPTDGFIDCHFGDGTLETE
QSFGLYGNKYTLRAKRKVNYETEDSESSFVTHNSKISLPHPMEIGESLDGTLKSRKRRKM
SKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPLKDFWPKV
PDSPATKYPIYPLTPKKSHRRKSKHKSAKKKTGKQQRTNNENIKRTLSFRKKRSHAILSP
PSPSYNAETEDCDLNYSDVMSKLGFLSERSTSPINSSPPRCWSPTDPRAEEIMAAAEKEA
MLFKGPNVCKKTVNSHIGKTSRARAQVKKSKAKLANPSVVTKKRNKRNQTNKLVDDGKKK
PRAKQKTNEKGTSRKHITLKDEKIKSQSGAEVKFVLKHQNVSEFASSSGGSQLLFKQKDM
PLMGSAVDHALSAPLPTGINAQQKLSGCFSSFLESKKSVDLQTFPSSRDDLHPSVVCNSI
GPGISKINVQRPHNQSAMFTLKESTLIQKNIFDLSNHLSQVAQNTHISSGMSSKIEDNAN
NIQRNYLSSIGKLSEYRNSLESKLDQAYTPNFLHCKDSQQQIVCIAEQSKHSETCSPGNT
ASEESQMPNNCFVTSLRSPIKQIAWEQKQRGFILDMSNFKPRVKQRSLSEAISQTALSQC
KNRNVSTPSAFGEGQSGLAVLKELLQKRQQKAQNANITQDPLSNKHQPNTNISGSLEHTK
GNKRTRSVTSPRKPRTPRSTKQKEKIPRLLKVDSLNLQNPSQLDNSVSDDSPIFFSDPGF
ESCYSLEDSLSPEHNYNFDINTIDQTGFCSFYSGSQFVPADQNLPQKFLSDAVQDLFPGQ
AIEKNEFLSHDNQKCDEDTHHTADSASWIRSGTLSPEIFEKSSIDSNENHRHNQWKNSFH
PLTTRSNSIMDSFCVQQAEDCLNEKSRLNRSSVSKEVFLSLPQPNNSDWIQGHTRKEMGQ
SLDSANTSFTTILSSPDGELVDMACEDLELYVSRNNDMLTPTPDSSPRSASSPSQSKNGS
FTPRTANILKPLMSPPSREEIMATLLDHDLSETIYQEPFCSNPSDVPEKPREIGGRLLMV
ETRLANDLAEFEGDFSLEGLRLWKTAFSAMTQNPRPGSPLRSGQGAVNKGSSNSPKMVED
KKIVIMPCKCAPSRQLVQVWLQAKEEYERSKKLPKTKPTGVVKSAENFSSSVNPDDKPVV
PPKMDVSPRILPTTAHTKEDVDNSQIALQAPATGCSQTASESQMLPPVASASDPEKDEDD
DDNYYISYSSPDSPVIPPWQQPVSPNSKALNGDDRPSSPVEELPSLAVENFLKPIKDGIQ
KSPCSEPQEPLVISPINTRARTGKCESLCLHSTPIIQRKLLERLPEATGLSPLSTEPKTQ
KLSNKKGSNTDTLRRVLLTQAKNQFAAVNTPQKETSQIDGPSLNNTYGFKVSIQNLQEAK
ALHEIQNLTLISVELHARTRRDLEPDPEFDPICALFYCISSDTPLPDTEKTELTGVIVID
KDKTVFSQDIRYQTPLLIRSGITGLEITYAADEKALFHEIANIIKRYDPDILLGYEIQMH
SWGYLLQRAAALSVDLCQMISRVPDDKIENRFAAERDEYGSYTMSEINIVGRITLNLWRI
MRNEVALTNYTFENVSFHVLHQRFPLFTFRVLSDWFDNKTDLYRWKMVDHYVSRVRGNLQ
MLEQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIPVTPSVQQRSQM
RAPQCVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENLGKNDESFGT
SLKVPPDLLYVRHDITVSPNGVAVKPSVRKGVLPRMLEEILKTRFMVKQSMKAYRQDRAL
SRMLDARQLGLKLIANVTFGYTSANFSGRMPCIEVGDSIVHKARETLERAIKLVNDTKKW
GARVVYGDTDSMFVLLKGATKEQSFKIGQEIAEAVTATNPKPVKLKFEKVYLPCVLQTKK
RYVGYMYETLDQKDPVFDAKGIETVRRDSCPAVSKILERSLKLLFETRDISLIKQYVQRQ
CMKLLEGKASIQDFIFAKEYRGSFSYKPGACVPALELTRKMLTYDRRSEPQVGERVPYVI
IYGTPGVPLIQLVRRPVEVLQDPTLRLNATYYITKQILPPLARIFSLIGVDVFSWYHELP
RIHKATSSSRSEPEGRKGTISQYFTTLHCPVCDDLTQHGICSKCRSHPQHVAVILNQEIR
ELERKQEQLVKICKNCSGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQC
Download sequence
Identical sequences H2PK25
ENSPPYP00000018949 9600.ENSPPYP00000018949 ENSPPYP00000018949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]