SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018954 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018954
Domain Number 1 Region: 68-135
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000155
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 226-270
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000118
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000018954
Domain Number - Region: 132-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.000126
Family VWC domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018954   Gene: ENSPPYG00000016931   Transcript: ENSPPYT00000019703
Sequence length 372
Comment pep:known_by_projection chromosome:PPYG2:6:114244057:114261233:1 gene:ENSPPYG00000016931 transcript:ENSPPYT00000019703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKRRLLYPSGWLHGPSDMQGLLFSTLLLAGLAQFCCRAQGTGPLDTTPEGRPGEVSDAP
QRKQFCHWPCKCPHRKPRCPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDY
SVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAG
SHCSGAKGGKKSDQSNCSLEPLLQQLSTSYETMPAYRNLPLIWKKKCLVQATKWTPCSRT
CGMGISNRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKAEKFVF
SGCSSIQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCR
EPGDIFSELKIL
Download sequence
Identical sequences H2PK30
ENSPPYP00000018954 XP_002817304.1.23681 ENSPPYP00000018954 9600.ENSPPYP00000018954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]