SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018990 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018990
Domain Number 1 Region: 276-362
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-23
Family PDZ domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000018990
Domain Number - Region: 85-189
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000942
Family Myosin rod fragments 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018990   Gene: ENSPPYG00000016964   Transcript: ENSPPYT00000019739
Sequence length 445
Comment pep:known chromosome:PPYG2:6:119841519:119885520:-1 gene:ENSPPYG00000016964 transcript:ENSPPYT00000019739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQA
DITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVH
DQLLQLHSIQLQLHAKTGQSVDSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVK
LLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQL
EAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLG
ISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQD
DENVEYEDESGHRYRLYLDELEGGGNPGASCKDPSGEIKVLQGFNKKAVTDTHENGDLGT
ASETPLDDGASKLDDLHTLYHKKSY
Download sequence
Identical sequences H2PK66
9600.ENSPPYP00000018990 ENSPPYP00000018990 ENSPPYP00000018990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]