SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019021 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019021
Domain Number 1 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000628
Family Hairy Orange domain 0.00013
Further Details:      
 
Domain Number 2 Region: 49-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000981
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019021   Gene: ENSPPYG00000016987   Transcript: ENSPPYT00000019772
Sequence length 337
Comment pep:known_by_projection chromosome:PPYG2:6:128247855:128259587:1 gene:ENSPPYG00000016987 transcript:ENSPPYT00000019772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPL
HPHHWAAAFHHLPAALLQPNGLHASESTPCRFSTTSEVPPAHGSALLTATFAHADSALRM
PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQPTSSGTNSKPYRPWGTEVGAF
Download sequence
Identical sequences H2PK97
ENSPPYP00000019021 XP_002817374.1.23681 9600.ENSPPYP00000019021 ENSPPYP00000019021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]