SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019083 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019083
Domain Number 1 Region: 83-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019083   Gene: ENSPPYG00000017041   Transcript: ENSPPYT00000019835
Sequence length 272
Comment pep:known_by_projection chromosome:PPYG2:6:140326781:140327599:-1 gene:ENSPPYG00000017041 transcript:ENSPPYT00000019835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAG
AKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRK
LSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANAVHP
VHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCP
CTICQMPPPPHLSALSTANMARLSAESKDLLK
Download sequence
Identical sequences G1SC92 H2PKF6
9600.ENSPPYP00000019083 ENSPPYP00000019083 ENSNLEP00000023142 ENSPPYP00000019083 ENSNLEP00000023142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]