SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019141 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019141
Domain Number 1 Region: 154-244
Classification Level Classification E-value
Superfamily PKD domain 0.00000000405
Family PKD domain 0.0084
Further Details:      
 
Domain Number 2 Region: 254-291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000942
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019141   Gene: ENSPPYG00000017095   Transcript: ENSPPYT00000019896
Sequence length 446
Comment pep:known_by_projection chromosome:PPYG2:6:152948480:153001860:-1 gene:ENSPPYG00000017095 transcript:ENSPPYT00000019896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEQLLEEFRRQLQQERTQEELELELRAGGGPQEDCPGPGGGGYSAMPDAIIRTKDSLAAG
ASFLRAPAAVRGWRQCVAACCSEPRCSVAVVELPRRPAPPAAVLGCYLFNCTARGRNVCK
FALHSGYSSYSLSRAPDGAALATARASPRQEKDAPPLSKAGQDVVLHLPTDGVVLDGRES
TDDHAIVQYEWALLQGDPSVDMKVPQSGTLKLSHLQEGTYTFQLTVTDTAGQRSSDNVSV
TVLRAAYSTGGCLHTCLRYHFLCDDGCCIDITLACDGVQQCPDGSDEGFCQNLGLDRKMV
THTAASPALPRTTGPSEDAGGDSLVEKSQKATAPNKPPALSNTEKRNHSAFWGPESQIIP
VMPDSSSSGKNRKEESYIFESKGDRGGGEHPAPETGAVLPLALGLAITALLLLMVACRLR
LVKQKLKKARPITSEESDYLINGMYL
Download sequence
Identical sequences H2PKL3
ENSPPYP00000019141 ENSPPYP00000019141 9600.ENSPPYP00000019141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]