SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019158 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000019158
Domain Number - Region: 195-307
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000262
Family Myosin rod fragments 0.0023
Further Details:      
 
Domain Number - Region: 429-514
Classification Level Classification E-value
Superfamily Prefoldin 0.00497
Family Prefoldin 0.014
Further Details:      
 
Domain Number - Region: 27-161
Classification Level Classification E-value
Superfamily Tropomyosin 0.0484
Family Tropomyosin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019158   Gene: ENSPPYG00000017111   Transcript: ENSPPYT00000019913
Sequence length 609
Comment pep:known_by_projection chromosome:PPYG2:6:154746153:154871400:1 gene:ENSPPYG00000017111 transcript:ENSPPYT00000019913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLDCTSHIALGAASPAPEETYDHLSEVPVTREQLNHYRDVAQNARSELAATLVKFECAQ
SELRDLRSKMLSKEVSCQELKAEMESYKENNARKSSLLTSLRDRVQELEEESAALSTSKI
RTEITAHTAIKENQELKKKVVELNEKLQKCSKENEENKKQVSKNCREHEEFLTQLRDCLD
PDERNDKASDEDLILKLRELRKENEFVKGQIVILEETINVHEMEAKASRETIMRLASEVN
REQKKAASCTEEKDKLNQMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQG
QLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMAAELGFDMRLDMFLARTE
QLVRLESNAVIENKTIAQNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTAVVV
ERDNAHLTIRKLQKKVERLQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKS
RDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNVIEVVTSEMKTLKKSLEEAEKR
EKQLADFREVVSQMLGLNVTSLALPDYEIIKCLERLIHSHQHHFVTCACLKDVTTGQERH
PQGHLQLLH
Download sequence
Identical sequences H2PKN0
ENSPPYP00000019158 9600.ENSPPYP00000019158 ENSPPYP00000019158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]