SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019204 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019204
Domain Number 1 Region: 1-134,246-385
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.63e-54
Family CAF1-like ribonuclease 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019204   Gene: ENSPPYG00000017148   Transcript: ENSPPYT00000019960
Sequence length 530
Comment pep:known_by_projection chromosome:PPYG2:6:163300997:163324952:1 gene:ENSPPYG00000017148 transcript:ENSPPYT00000019960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVGADEFEESLPLLQELVQEADFVGLDIEFTGLRSNLSGPQQISLFDLPSEWYLKTRQS
VQQFTICQIGDSIVSPWEPEFFKWYTAHSCNFYLFPTTFGILDSEFSFQASSVQFLNQYG
FNYNKFLKNGIPYMNEEQEKKIRHDILTGNWRVRSSPDKDQIKVVIDEVTRWLDLAKEGD
WMTLPGITGFQAFEVQLVLRQALPNIWTVLKDEGVVVKKVSKQHRWYLQNTSCDRESCWK
ENILLSARGFSAFFQMLVKAQKPLVGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFP
VLIDTKSVTKDIWKVMNRIALAGVQWRDLGSLQPPTPLMGRVSNDCSILSPPVETKCPHE
AAYDAFLCGSVLLKVAHLLLQKVHRIDPVPESSFPQYLDVLAPYVNQVNLIRAGVPKINF
SGPDYPGIRPPILILSVKRWPGVSEQQVYHKFQNLCKFDVRRLTRSQFLLLTNKFKDARN
ILKEYRGHPTLCISLYRYWRHSPNVNCLLQVCGIVTAWALLAFTLGRSGP
Download sequence
Identical sequences H2PKS6
ENSPPYP00000019204 ENSPPYP00000019204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]