SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019207 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019207
Domain Number 1 Region: 144-523
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.31e-50
Family LacY-like proton/sugar symporter 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019207   Gene: ENSPPYG00000017150   Transcript: ENSPPYT00000019963
Sequence length 554
Comment pep:known_by_projection chromosome:PPYG2:6:163643173:163680797:1 gene:ENSPPYG00000017150 transcript:ENSPPYT00000019963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVDDILEQVGEFGWFQKQAFLILCLLSAAFAPICVGIVFLGFIPDHHCQSPGVAELSQ
RCGWSPAEELNYTVPGLGPAGEAFLAQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFFFGSLGVGYFADRFGRKLCLL
GTVLVNAVSGVLLAFAPNYVSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
IMDHIAQKNGKLPPADLKMLSLKEDVTEKLSPSFADLFRMPRLRKHTFILMYLWFTASVL
YQGLILHMGATSGNLYLDFLYSALVEFPGAFITLITIDRVGRIYPTAVSNLLAGAACLFM
IFISPDLHWLNLIIMCVGRMGITITIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
PFIVFRLMEIWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
TTYLEVQTSEPLGT
Download sequence
Identical sequences H2PKS9
ENSPPYP00000019207 XP_002817591.1.23681 ENSPPYP00000019207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]