SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019208 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019208
Domain Number 1 Region: 145-524
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.19e-49
Family Glycerol-3-phosphate transporter 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019208   Gene: ENSPPYG00000017151   Transcript: ENSPPYT00000019964
Sequence length 534
Comment pep:known chromosome:PPYG2:6:163742675:163786634:-1 gene:ENSPPYG00000017151 transcript:ENSPPYT00000019964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFTPIYVGIVFLGFTPDHRCRSPGVAELS
LRCGWSPAEELNYTVPGPGPAGEASPRQCGRYEVDWNQSAFGCVDPLASLDTNRSRLPLG
PCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQASVNVGFFFGSMSIGYIADRFGRKLCL
LTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIF
YQVAYTVGLLVLAGVAYALPHWRWLQFTVTLPNFFFLLYYWCIPESPRWLISQNKNAEAM
RIIKHIAKKNGKSLPASLQCLRLEEETGEKLNPSFLDLVRTPQIRKHTMILMYNWFTSSV
LYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLA
SVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGII
TPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQR
Download sequence
Identical sequences H2PKT0
ENSPPYP00000019208 9600.ENSPPYP00000019208 ENSPPYP00000019208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]