SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019220 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019220
Domain Number 1 Region: 462-765
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.59e-102
Family PDEase 0.000000602
Further Details:      
 
Domain Number 2 Region: 248-439
Classification Level Classification E-value
Superfamily GAF domain-like 6.54e-48
Family GAF domain 0.000029
Further Details:      
 
Domain Number 3 Region: 91-240
Classification Level Classification E-value
Superfamily GAF domain-like 1.5e-19
Family GAF domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019220   Gene: ENSPPYG00000017162   Transcript: ENSPPYT00000019977
Sequence length 780
Comment pep:known_by_projection chromosome:PPYG2:6:169064582:169405238:-1 gene:ENSPPYG00000017162 transcript:ENSPPYT00000019977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVSESVSAETIEKWLKRKNNKSEDESA
PKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGE
CNNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGL
ESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQV
CRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKEL
YSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLY
TGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYH
RIRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGI
FVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFT
DLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHN
IFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLM
MTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGF
YNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED
Download sequence
Identical sequences H2PKU2
9600.ENSPPYP00000019220 ENSPPYP00000019220 ENSPPYP00000019220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]