SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019261 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019261
Domain Number 1 Region: 72-125
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 3.57e-17
Family Transcriptional factor domain 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000019261
Domain Number - Region: 14-44
Classification Level Classification E-value
Superfamily RING/U-box 0.0131
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019261   Gene: ENSPPYG00000017196   Transcript: ENSPPYT00000020019
Sequence length 126
Comment pep:known_by_projection chromosome:PPYG2:6_cox_hap1:152107:156314:1 gene:ENSPPYG00000017196 transcript:ENSPPYT00000020019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVMDVASTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCTRCGFNINVRDFEGKVVKTSVV
FHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKF
QEKEDS
Download sequence
Identical sequences H2PKY3
ENSPPYP00000019261 XP_009232683.1.23681 XP_009235369.1.23681 XP_009245716.1.23681 XP_009249418.1.23681 9600.ENSPPYP00000019261 ENSPPYP00000019261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]