SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019293 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019293
Domain Number 1 Region: 7-123
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 8.61e-43
Family MHC antigen-recognition domain 0.0000055
Further Details:      
 
Domain Number 2 Region: 122-219
Classification Level Classification E-value
Superfamily Immunoglobulin 9.38e-27
Family C1 set domains (antibody constant domain-like) 0.00000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019293   Gene: ENSPPYG00000017217   Transcript: ENSPPYT00000020052
Sequence length 266
Comment pep:novel chromosome:PPYG2:6_cox_hap1:1082119:1095435:-1 gene:ENSPPYG00000017217 transcript:ENSPPYT00000020052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCLKLPGGSSLAALTVTLMVLSSPLALSGDTRPRFLEYSTSECYFFNGTERVRFVERYI
YNQEENLRFDSDVGEFRAVTELGRPDAENWNSQKKSFLEDRRAAVDTFCRHNYGVGESFT
VQRRVQPRVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIRN
GDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGL
LFLGTGLFIYFRNQKGHSRLPPTGLS
Download sequence
Identical sequences H2PL15
ENSPPYP00000019293 9600.ENSPPYP00000019293 ENSPPYP00000019293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]