SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019404 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019404
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.63e-31
Family Galectin (animal S-lectin) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019404   Gene: ENSPPYG00000017316   Transcript: ENSPPYT00000020170
Sequence length 144
Comment pep:known_by_projection chromosome:PPYG2:7:2414036:2416188:-1 gene:ENSPPYG00000017316 transcript:ENSPPYT00000020170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQFEAFCAGGLAPGWNLLVQGHADSGEDRFETNFLLETGDIAFHIKSQFSSTAVVGNA
FQGGRWGPEQVSSIFPLAPGEPLEMEVSSDARHFHVYALEHKVLQFPRRQRPLGAITRVR
VLNDHRLVQVELAKRGLSWGDWGY
Download sequence
Identical sequences H2PLC3
9600.ENSPPYP00000019404 ENSPPYP00000019404 ENSPPYP00000019404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]