SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019447 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019447
Domain Number 1 Region: 5-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-26
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 446-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.85e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 389-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-23
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 5 Region: 334-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.88e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.61e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 529-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 627-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 239-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000044
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 10 Region: 492-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000328
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000019447
Domain Number - Region: 207-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00485
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019447   Gene: ENSPPYG00000017356   Transcript: ENSPPYT00000020214
Sequence length 697
Comment pep:known_by_projection chromosome:PPYG2:7:6693219:6711435:-1 gene:ENSPPYG00000017356 transcript:ENSPPYT00000020214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKSLGPVSFKDVAVDFTQEEWQQLDPEQKITYRDVMLENYSNLVSVGYHIIKPDVISKL
EQGEEPWIVEGEFLLQSYPDEVWQTDDLKERIQEEENKPLRQTVFIETLIEERGNVPGKT
FDVETNPVPSRKIAYKNSLCDSCEKCLTSVSEYISSDGSYARMKADECSGCGKSLLHIKL
EKTHPGDKAYEFNQNGEPYTLNEESLYQKIRILEKPFEYIECQKAFQKDTVFVNHMEEKP
YKWNGSEIAFLQMSDLTVHQTSHMEMKPYECSECGKSFCKKSKFIIHQRTHTGEKPYECN
QCGKSFCQKGTLTVHQRTHTGEKPYECNECGKNFYQKLHLIQHQRTHSGEKPYECSYCGK
SFCQKTHLTQHQRTHSGERPYVCHDCGKTFSQKSALNDHQKIHTGVKLYKCSECGKCFCR
KSTLTTHLRTHTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECNECGKTFYLNSAL
MRHQRVHTGEKPYECNECGKLFSQLSYLTIHHRTHSGVKPYECSECGKTFYQNSALCRHR
RIHKGEKPYECYICGKFFSQMSYLTIHHRIHSGEKPYECSECGKTFCQNSALNRHQRTHT
GEKAYECYECGKCFSQMSYLTIHHRIHSGEKPFECNECGKAFSRMSYLTVHYRTHSGEKP
YECTECGKKFYHKSAFNSHQRIHRRGNMNVIDVGRLL
Download sequence
Identical sequences H2PLG5
ENSPPYP00000019447 ENSPPYP00000019447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]