SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019452 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019452
Domain Number 1 Region: 75-135
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.1e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019452   Gene: ENSPPYG00000017361   Transcript: ENSPPYT00000020219
Sequence length 190
Comment pep:known_by_projection chromosome:PPYG2:7:7010469:7011041:1 gene:ENSPPYG00000017361 transcript:ENSPPYT00000020219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAAGAPGEGRRRR
PGPSGPAGRRDSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLA
KNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQQVAGGALGATEAQPQGHLQRYS
TQIHSFREGT
Download sequence
Identical sequences H2PLH0
ENSPPYP00000019452 ENSPPYP00000019452 XP_009240821.1.23681 9600.ENSPPYP00000019452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]