SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019461 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019461
Domain Number 1 Region: 237-353
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.48e-21
Family Myosin rod fragments 0.0035
Further Details:      
 
Domain Number 2 Region: 2-102
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.46e-17
Family Myosin rod fragments 0.0021
Further Details:      
 
Domain Number 3 Region: 432-553
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000000115
Family Myosin rod fragments 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000019461
Domain Number - Region: 97-183
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0011
Family Myosin rod fragments 0.0034
Further Details:      
 
Domain Number - Region: 357-435
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0131
Family Myosin rod fragments 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019461   Gene: ENSPPYG00000017371   Transcript: ENSPPYT00000020230
Sequence length 585
Comment pep:novel chromosome:PPYG2:7:8179764:8196893:1 gene:ENSPPYG00000017371 transcript:ENSPPYT00000020230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALDHKVRTLTGDLSLREDSIAKLQKEKRALEELHQKTLDDLQAEEDKVNHLTKNNSKLST
QIHELEDNWEQEKKIRAEVEKARRKAESDLKMTIDNLNEMERSKLDLEEVVKKRDLEINS
VNSKYEDEQSLNSTLQRKLKEHQARIEELEEELEAERTMRAKIEQNRKREAELLKLRREL
EEAALQSEATASTLRKKHMDSMAELTEHVESLQRVKSKLEKDKQVMKAEIDDLNASVEMI
QKSKMNAEAHVRKLEDSLSEANAKVAELERNQAEINAIRTRLQAENSELSREYEESQSRL
NQILRIKTSLTSQVDDYKRQLDEESKSRSTAVVSLANTKHDLDLVKEQLEEEQGGKSELQ
RLVSKLNTEVTTWRTKYETDAIQRTEELEETKRKLAARLQEAEEAAETAQARAASLEKNK
QRLQAEVEDLTIDLEKANAAAAALDKKQRLFDKMLAEWQQKCEELQVEVDSSQKECRMYM
TESFKIKTAYEESLEHLESVKKENKTLQEEIKDLIDQLGEGGRSVHELQKLKKKLEMEKE
ELQVALEEAESSLEVEESKVIRIQLELAQVKADIDRRIHEKEEEF
Download sequence
Identical sequences H2PLH9
9600.ENSPPYP00000019461 ENSPPYP00000019461 ENSPPYP00000019461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]