SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019474 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019474
Domain Number 1 Region: 7-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 266-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-16
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 363-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.88e-16
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 213-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000176
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 6 Region: 154-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000154
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019474   Gene: ENSPPYG00000017380   Transcript: ENSPPYT00000020243
Sequence length 425
Comment pep:known_by_projection chromosome:PPYG2:7:8376263:8393203:1 gene:ENSPPYG00000017380 transcript:ENSPPYT00000020243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPPARGKELLSFEDVAMYFTREEWGHLSWGQKDLYRDVMLENYRNMVLLGFQFPKPEVI
CQLENWDEQWILDLPRAGNRKASGSACPGSEARHKMKKLTPKQKFSEDLDSYKISVVMQE
SAEKLSKKLHKCKEFVDSCRLTFPTSGDEYSRGFLQNLNLIQDQNAQTRWKQGRYDEDGK
PFNQRSLLLGHEQILTRAKSYECSECGKVIRRKAWFDQHQRIHFLENPFECKVCGQAFRQ
RSALTVHKQCHLQNKPYRCHDCGKCFRQLAYLVEHKRIHTKEKPYKCSKCEKTFSQNSTL
IRHQVIHSGEKRHKCLECGKAFGRHSTLLCHQQIHSKPNTHKCSECGQSFGRNVDLIQHQ
RIHTKEEFFQCGECGKTFSFKRNLFRHQVIHTGSQPYQCVICGKSFKWHTSFIKHQGTHK
GQIST
Download sequence
Identical sequences H2PLJ2
9600.ENSPPYP00000019474 ENSPPYP00000019474 ENSPPYP00000019474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]