SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019495 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019495
Domain Number 1 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 46-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-21
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 377-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 173-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000846
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019495   Gene: ENSPPYG00000017396   Transcript: ENSPPYT00000020265
Sequence length 446
Comment pep:known chromosome:PPYG2:7:9055335:9065109:-1 gene:ENSPPYG00000017396 transcript:ENSPPYT00000020265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYF
IRKEWKRLEHAQRDLYRDVMLENYGNVFSLDHETRTENDQEICEDTRSHGVLLGRFQKDI
SQGLKFKEAYEREVSLKRPLGNSPGERLNRKMPDCGQVTVEEKLTPRGERSEKYNDFGNS
FTVNSNLISHQRHSVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECNECGKAFSQS
SHLIQHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLT
HHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQR
IHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTG
EKPLNGMGMSKSSLRVTTELNIREST
Download sequence
Identical sequences H2PLL3
ENSPPYP00000019495 XP_009240879.1.23681 XP_009240880.1.23681 XP_009240881.1.23681 XP_009240882.1.23681 ENSPPYP00000019495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]