SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019539 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019539
Domain Number 1 Region: 479-756
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.51e-79
Family Protein kinases, catalytic subunit 0.000000000646
Further Details:      
 
Domain Number 2 Region: 192-397
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-33
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 3 Region: 775-844
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.55e-19
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Domain Number 4 Region: 2-65
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.5e-19
Family Ephrin receptor ligand binding domain 0.0000367
Further Details:      
 
Domain Number 5 Region: 120-190,231-245
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000432
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019539   Gene: ENSPPYG00000017429   Transcript: ENSPPYT00000020310
Sequence length 857
Comment pep:known_by_projection chromosome:PPYG2:7:9872746:9896690:-1 gene:ENSPPYG00000017429 transcript:ENSPPYT00000020310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSL
HLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAIPAPGPSPSLYCREDGQWAEQPV
TGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSAVCQCRIGYFR
ARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALRCRECRPGGSC
APCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPVPFEPVNVTTD
REVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSEN
RAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVV
LVLVVIVVAVLCLRKQSSGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEI
DVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQ
FEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRY
LAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGGKIPIRWTAPE
AIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLH
QLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFG
SVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKS
QSKPGTPGGTGGPAPQY
Download sequence
Identical sequences H2PLQ6
ENSPPYP00000019539 ENSPPYP00000019539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]