SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019596 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019596
Domain Number 1 Region: 102-191
Classification Level Classification E-value
Superfamily GTF2I-like repeat 8.63e-34
Family GTF2I-like repeat 0.00095
Further Details:      
 
Domain Number 2 Region: 327-413
Classification Level Classification E-value
Superfamily GTF2I-like repeat 3.01e-30
Family GTF2I-like repeat 0.001
Further Details:      
 
Domain Number 3 Region: 546-939
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000986
Family Hermes transposase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019596   Gene: ENSPPYG00000017480   Transcript: ENSPPYT00000020367
Sequence length 949
Comment pep:novel chromosome:PPYG2:7:13004250:13075454:-1 gene:ENSPPYG00000017480 transcript:ENSPPYT00000020367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVAVSTLPVEEESSSESRMVVTFLVSALESMCKELAKSKAEVACIAVYETDVFVVGTE
RGCAFVNARTDFQKDFAKYCVAEGLREVKPPCPVNGMQVHSGETEILRKAVEDYFCFCYG
KALGTTVMVPVPYEKMLRDQSAVVVQGLPEGVAFQHPENYDLATLKWILENKAGISFIIN
RPFLGPESQLGGPGMVTDAERSIVSPSESCGPINVKTEPMEDSGISLKAEAVSVKKESED
PNYYQYNMQGSHPSSTSNEVIEMELPMEDSTPLVPSEESNKDPEAEVKMEGNTNSSSVTN
SAAGVEDLNIVQVTVPDNEKERLSSIEKIKQLREQVNDLFSRKFGEAIGVDFPVKVPYRK
IPFNPGCVVIDGMPPGVVFKAPGYLEISSMRRILEAAEFIKFTVIRPLPGLELSNVGKRK
IDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYTER
MRDEKLHELKKGLRKYLLGSSDTDCPEQKQVFANPSPTQKSPVQPVEDLAGNLWEKLREK
IRSFVSYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVE
KSLKKFCIDWSKLVSVASTGTPAMVDANNGLVTKLQSRVATFCKGAELKSVCCIIHPESL
CAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVL
KRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNTLNISLQGHSQIVTQM
YDLIRAFLAKLCLWETHLARNNLAHFPTLKSVSRNESDGLNYIPKIAELKTEFQKRLSDF
KLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLWGSYPK
YKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLHIAT
Download sequence
Identical sequences H2PLW1
9600.ENSPPYP00000019596 ENSPPYP00000019596 ENSPPYP00000019596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]