SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019602 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019602
Domain Number 1 Region: 197-332
Classification Level Classification E-value
Superfamily Cap-Gly domain 7.46e-39
Family Cap-Gly domain 0.00000231
Further Details:      
 
Domain Number 2 Region: 74-182
Classification Level Classification E-value
Superfamily Cap-Gly domain 7.59e-33
Family Cap-Gly domain 0.00000723
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000019602
Domain Number - Region: 832-918
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00018
Family Myosin rod fragments 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019602   Gene: ENSPPYG00000017486   Transcript: ENSPPYT00000020374
Sequence length 1046
Comment pep:known_by_projection chromosome:PPYG2:7:13619913:13747534:-1 gene:ENSPPYG00000017486 transcript:ENSPPYT00000020374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKPSGLKPPGRGGKHSSPMGRTSTGSASSSAAVATGSKEGSPLHKQSSGPSSSPAAAAA
PEKPGPKAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKN
DGAVGGVRYFECPALQGIFTRPSKLTRQPTAEGSGSDAHSVESLTAQNLSLHSGTATPPL
TSRVIPLRESVLNSSVKTGNESGSNLSDSGSVKRGDKDLRLGDRVLVGGTKTGVVRYVGE
TDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGFPSTSPAKAKK
TKRMAMGVSALTHSPSSSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEA
LKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLL
VDCVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLETQTQLEHARIGELEQSLLLE
KAQAERLLRELADNRLTTVAEKSRVLQLEEELTLRRGEIEELQQCLLHSGPPPPDHPDAA
ETLRLRERLLSASKEHQRESGVLRDKYEKALKAYQAEVDKLRAANEKYAQEVAGLKDKVQ
QATSENMGLMDNWKSKLDSLASDHQKSLEDLKATLNSGPGAQQKEIGELKAVMEGIKMEH
QLELGNLQAKHDLETAMHVKEKEALREKLQEAQEELAGLQRHWRAQLEVQASQHRLELQE
AQDQRRDAELRVHELEKLDVEYRGQAQAIEFLKEQISLAEKKMLDYERLQRAEAQGKQEV
ERLREKLLVAENRLQAVEALCSSQHTHMIESNDISEETIRMKETVEGLQDKLNKRDKEVT
ALTSQTEMLRAQVSALESKCKSGEKKMDALLKEKRRLEAELETVSRKTHDASGQLVLISQ
ELLRKERSLNELRVLLLEANRHSPGPERDLSREVHKAEWRIKEQKLKDDIRGLREKLTGL
DKEKSLSDQRRYSLIDPSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDK
AQTIGNSGSANGIHQQDKAQKQEDKH
Download sequence
Identical sequences H2PLW7
ENSPPYP00000019602 ENSPPYP00000019602 9600.ENSPPYP00000019602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]