SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019615 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019615
Domain Number 1 Region: 46-117
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.06e-20
Family Chaperone J-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019615   Gene: ENSPPYG00000017499   Transcript: ENSPPYT00000020387
Sequence length 226
Comment pep:known_by_projection chromosome:PPYG2:7:14390829:14391509:1 gene:ENSPPYG00000017499 transcript:ENSPPYT00000020387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMLWRWWPRLLPWRFLQTRGFPQNSAPSLGLGARTYSQGDCSYSRTALYDLLGVPSTA
TQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDL
RGPGVRPSRTPAPDPGSPRTPPPTSRTHDGSRASPGAKRTMFNFDAFYQAHYGEQLERER
RLRARREALRKRQEYRSLKGLRWEETRDTAAIFLIFSIFIIIGFYI
Download sequence
Identical sequences H2PLY0
ENSPPYP00000019615 9600.ENSPPYP00000019615 XP_002817906.1.23681 ENSPPYP00000019615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]