SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019617 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019617
Domain Number 1 Region: 675-760
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.22e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019617   Gene: ENSPPYG00000017501   Transcript: ENSPPYT00000020389
Sequence length 879
Comment pep:known_by_projection chromosome:PPYG2:7:14448709:14483451:1 gene:ENSPPYG00000017501 transcript:ENSPPYT00000020389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRHGWPRAVPRAARSRDQAVAAATAMAGVLAGLAAGLQVPRVAPSPDSDSDTDSEDPS
LRRTAGGLLRSQVIHSGHFMVSSPHSDSLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECL
SLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVERRKSPVCGFVTPLQGPE
ADAHRKPEAVVLEGNYWKRRIEVVMREYHKWRIYYKKRLRKPSREEDLLAPKQAEGRWPP
PEQWCKQLFSSVVPVLLGDPEEEPGGRQLLDLNCFLSDISDTLFTMTQSSPSPLQLPPED
AYVGNADMIQPDLTPLQPSLDDFMDISDFFTNSRPPQPPMPSNFPEPPSFSPVVDSLFSS
GTLGPEVPPAPSAMTHLSGHSRLQARNSCPGPLDSSAFLSSDFLLPEDPKPRLPPPPVPP
PLLHYPPPAKVPSLEPCPQPPFPPMAPPTALLQEEPLFSPRFPFPTVPPAPGVSPLPAPA
AFPPTPQSVPSPAPTPFPIELLPSGYSEPAFGPCFSMPRGKPPAPSPRGQKASPPTLAPA
TASPPTTAGSNNPCLTQLLTAAKPEQALEPPLVSSTLLRSPGSPQETVPEFPCTFLPPTP
APTPPRPPPGPATLAPSRPLLVPKAERLSPPVLSGNERRLSGDLSSMPGPGTLSVHVSPP
QPILSRGRPDSNKTENRRITHISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTL
QKTAEYILMLQQERAGLQEEAQQLRDEIEELNAAINLCQQQLPATGVPITHQRFDQMRDM
FDDYVRTRTLHNWKFWVFSILIRPLFESFNGMVSTASVHTLRQTSLAWLDQYCSLPALRP
TVLNSLRQLGTSTSILTDPGRIPEQATRAVTEGTLGKPL
Download sequence
Identical sequences H2PLY2
ENSPPYP00000019617 ENSPPYP00000019617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]