SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019642 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019642
Domain Number 1 Region: 6-126
Classification Level Classification E-value
Superfamily HRDC-like 1.83e-32
Family RNA polymerase II subunit RBP4 (RpoF) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019642   Gene: ENSPPYG00000017525   Transcript: ENSPPYT00000020416
Sequence length 148
Comment pep:known_by_projection chromosome:PPYG2:7:21715134:21750728:-1 gene:ENSPPYG00000017525 transcript:ENSPPYT00000020416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRH
QSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTV
TSILPAEPEAEQKKKTNSDVAMDEEDPA
Download sequence
Identical sequences H2PM06
ENSPPYP00000019642 9600.ENSPPYP00000019642 ENSPPYP00000019642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]