SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019650 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019650
Domain Number 1 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 3 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 388-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.87e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 220-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 500-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 140-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000103
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019650   Gene: ENSPPYG00000017531   Transcript: ENSPPYT00000020424
Sequence length 564
Comment pep:known_by_projection chromosome:PPYG2:7:22449627:22483234:1 gene:ENSPPYG00000017531 transcript:ENSPPYT00000020424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLTFMDVAIEFSLEEWQCLDPAQQNLYRHVMLENYRNLVFLGIAVSKPDLITCLEQGK
EPWNMKRHEMVAKHLVMFYYFAQHLPEQNDSFQKVTLRRYRKCGYENLQLRKGCKSVVEC
KQHKGDYSGLNQCLKTTLSKIFQCNKYVEVFHKISNSNRHKMRHTEKKHFKCQQCGKTFC
MLSHLTQHKRIQTRVNFYKCEACVRAFNWSSTLNKHKRIHTGEKPYKCKECGKAFNQTSH
LIRHKRIHTEEKPYKCEECGKAFNQSSTLTTHNIIHTGEIPYKCEKCVRAFNQASKLTEH
KLIHTGEKRYECEECGKAFNQSSKLTEHKYIHTGEKPYKCEECGKAFNQSSILTTHKRIH
SGEKPYKCEECGKAFKQSSNLTDHKKIHTGEKPYKCEECGKAFNQLSNLTRHKLIHTGEK
PYKCGECGKAFNQSSALNTHKIIRTGENPHKCRESGKVFHLSSKLSTHKKIHTGEKLYKG
EECGKAFNRSSTLIGHKRIHTGEKPYKCEECGKAFNLSSNLTAHKKIHLGEKPYKCEECG
KAFNRSSTLTTHKIIHTEEKQYKC
Download sequence
Identical sequences H2PM14
ENSPPYP00000019650 ENSPPYP00000019650 9600.ENSPPYP00000019650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]