SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019661 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019661
Domain Number 1 Region: 14-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-25
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 305-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 418-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 251-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 473-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.66e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 193-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-19
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 8 Region: 155-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000457
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019661   Gene: ENSPPYG00000017541   Transcript: ENSPPYT00000020435
Sequence length 524
Comment pep:known_by_projection chromosome:PPYG2:7:27307364:27400619:1 gene:ENSPPYG00000017541 transcript:ENSPPYT00000020435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRPGPPGSREMGLLTFRDIAIEFSPEEWQCLDCAQRNLYRDVMLENYRNLVSLGIAVS
KPDLITCLEQNKESQNIKRNEMVAKHPVMHSHFTQDLQPEQGIKDSLQKVIPRTYGKCGH
ENLQFKKCCKIVGECEVHKGGYNEVNQCLSTTQNKIFQTHKYVKVFGKFLNSNRHKTRYT
GKKHFKCKKYGKSFCMLSHLNQHQVIQTREKSYKCKECGKSFNCSSNHTTHKIIHTGEKP
YRCEECGKVLSWSANLTRHKITHTGEKPYTCEECGQAFRHSSTLTNHKRIHTGERPYKCE
ECGKAYSLSSTLTDHKRIHTGEKPYTCEECGQAFRRSSTLTNHKRIHTGERPYKCEECGK
AFSWSSNLTGHKRIHTREKPYACEECGQAFSLSSNLTRHKRIHTGENPYTCEECGQDFRR
SSALTIHKRIHTGDRPYKCEECGKAFSLSSTLTDRKRIHTGERPYTCEECGKAFNCSSTL
MQHKRIHTGEKPYKCEECDQAFKWHSSLAEHKIIHTGEKPYKCE
Download sequence
Identical sequences H2PM25
ENSPPYP00000019661 9600.ENSPPYP00000019661 ENSPPYP00000019661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]