SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019683 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019683
Domain Number 1 Region: 131-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 2 Region: 167-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000108
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 460-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000256
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000019683
Domain Number - Region: 111-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0356
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019683   Gene: ENSPPYG00000017561   Transcript: ENSPPYT00000020457
Sequence length 519
Comment pep:known_by_projection chromosome:PPYG2:7:33494411:33605558:-1 gene:ENSPPYG00000017561 transcript:ENSPPYT00000020457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVE
TQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCD
ICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNY
ACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGTLYPVI
KEETNHGEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSTSYE
KENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQLHKPLAEGTPR
SNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAP
HARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIH
MGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS
Download sequence
Identical sequences H2PM47
ENSPPYP00000019683 ENSPPYP00000019683 9600.ENSPPYP00000019683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]